You have probably been as horrified and saddened as me to
see the shocking abnormality that affects newborn babies whose mothers have
been infected with the Zika virus. The
skulls and brains of the babies have not grown properly, and the babies appear
to have small heads, a condition known as "microcephaly". The standard definition is that the
circumference of the head is two (or three) standard deviations below average for
age and sex [1,2] (Fig. 1).
![]() |
Fig. 1. Diagram to show size of a baby’s head with microcephaly compared to a normal baby’s head. From https://prezi.com/iwv4kvehmhbv/microcephaly-then-and-now/. |
Origin and spread of the Zika virus
Zika virus has been known since the 1940s, and originally
occurred in the equatorial regions of Africa.
It is named after the Zika Forest near the Ugandan capital of
Entebbe. Analysis of the various
sequenced genomes has shown an origin in central Africa (a strain from Uganda
isolated in 1947 being the oldest), spreading elsewhere in Africa (Senegal
(1984), Nigeria (1968) and the Central
African Republic (1976)) and then spread westwards to Malaysia (1966), Cambodia
(2010), Micronesia (2007), French Polynesia (2013) and then Suriname and Brazil
(2015) [http://virological.org/t/initial-Zika-phylogeography/202]. The virus is transmitted by mosquitoes such
as Aedes aegypti (Fig. 2) and A. albopictus. These mosquitoes are active during the day,
mainly at dawn and dusk and when the weather is cloudy, and transmit the virus
from patient to patient when the females take a blood meal. A.
aegypti is known as the yellow fever mosquito, and is particularly
distinctive with white rings around the leg joints and white markings on the
body. This mosquito originated in Africa
but has since spread throughout the tropics [3]. There is also evidence that Zika virus can be
transmitted sexually via the semen of an infected man [4].
![]() |
Fig. 2. An Aedes aegypti mosquito (photo taken by Muhammad Mahdi Karim in Dar es Salaam, Tanzania, 2009). |
Zika fever, which has mild influenza-like symptoms, had been
thought to be a trivial disease. Now
there are a several questions that require answers. If there a causal link between microcephaly
and viral infection or are the symptoms coincidental? If the disease causes the symptoms, is this
an effect of viral enzymes, or a consequence of the body's own immunological
system attacking more than just the virus?
Microcephaly in Brazil
Microcephaly is not a new condition, and can result from
chromosomal abnormalities as well as environmental conditions that can affect
brain growth. Mutations in the genes
MCPH1, which encodes the protein microcephalin, and ASPM, which encodes
abnormal spindle-like microcephaly-associated protein, can cause primary
microcephaly when the gene is homozygous [5- 7]. Microcephaly is associated with other viral
diseases, such as chickenpox [8], but incidences are rare because women rarely
get the disease when pregnant because of the innate immunity they acquired
during childhood infection. It is
possible, of course, that the same may be true of Zika virus, which would
explain why microcephaly is not prevalent in Africa, because women acquire
immunity as girls, and would also explain the dramatic increase in the
condition in Brazil, where the disease arrived recently and pregnant women have
no immunity. The rates of Zika infection
and microcephaly in Brazil really are alarming.
It has been estimated that 1.5 million cases of Zika fever occurred in
Brazil between April 2015 and January 2016, and 3718 cases of microcephaly (38
of which led to death) [9], which is one case per 403 infections, and one case
per 793 births (the population of Brazil is 204 million and the annual birth
rate is 14.46 per 1000 [https://www.cia.gov/library/publications/the-world-factbook/geos/br.html]). This is considerably higher than the known
incidence of microcephaly in the UK (where the Zika virus is absent):
approximately 1 in 10,000 births in the UK [http://www.rightdiagnosis.com/m/microcephaly/basics.htm].
Zika virus polyprotein
The Zika virus is a flavivirus, a group that includes the
viruses that cause yellow fever, dengue fever, Japanese encephalitis and West
Nile fever. These viruses contain
single-stranded RNA as their genetic material, and the RNA encodes a single
polyprotein. This polyprotein consists
of several enzymes and structural proteins, and processing by an endogenous
serine endopeptidase is required to separate the individual proteins. By submitting the Zika virus polyprotein to
InterProScan, it is possible to identify all the components. These are shown below. There is no component with an unknown
function or one expected to affect brain development directly.
![]() |
Fig. 3. Zika virus polyprotein domains identified by InterProScan.
|
Fig. 4 Conservation of polyprotein cleavage sites
Sites of cleavage are indicated by an arrow. Residues highlighted in pink are conserved
between West Nile virus (W Nile) and Zika virus. Residue numbers are shown above and below
each sequence.
60
70 80
90 100 ↓
110
W Nile
APTRAVLDRWRGVNKQTAMKHLLSFKKELGTLTSAINRRSTKQKKRGGTAGFTILLGLIA
:. ....:: :.:. :.: : .:: ..::. :: :.::
::: .:. ..:.:..
Zika KPSTGLINRWGKVGKKEAIKILTKFKADVGTMLRIINNRKTK--KRGVETGI-VFLALLV
60
70 80 90
100 110
180
190 200 210 ↓ 220
230
W Nile
AAGNDPEDIDCWCTKSSVYVRYGRCTK--TRHSRRSRRSLTVQTHGESTLANKKGAWLDS
.:::.::::....... :: ::. : ..::::::.:. .:. . : .....::.:
Zika EPQYEPEDVDCWCNSTAAWIVYGTCTHKTTGETRRSRRSITLPSHASQKLETRSSTWLES
180 190
200 210 220
230
1370
↓
1380 1390 1400
1410 1420
W Nile
DPNRKRGWPATEVMTAVGLMFAIVGGLAELDIDSMAIPMTIAGLMFVAFVISGKSTDMWI
..::.:: .::::::::. ::::::.. ::: ::
::. ::. :..:.::::.::.:
Zika TASKKRSWPPSEVMTAVGLICAIVGGLTKTDID-MAGPMAAIGLLVVSYVVSGKSVDMYI
1370
1380 1390 1400
1410 1420
1490
1500 ↓ 1510 1520
1530 1540
W Nile
ILPSVIGFW-ITLQYTKRGGVLWDTPSPKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMV
: : . . : . .. ::.:..:: :::.: :::.::.:::::::: :::: :.:::::
Zika I-PFAAAAWFVYIKSGKRSGAMWDIPSPREVKKGETTAGVYRIMTRKLLGSTQVGAGVMH
1490 1500
1510 1520 1530
1540
2090
2100 2110 2120
↓ 2130 2140
W Nile
ITKLGERKILRPRWADARVYSDHQALKSFKDFASGKRS-QIGLVEVLGRMPEHFMGKTWE
::.::.:::.::: :::. :::
.:::::.::.:::. ::.:..: .: :. . :
Zika WTKFGEKKILKPRWMDARICSDHASLKSFKEFAAGKRTIATGLIEAFGMLPGHMTERFQE
2090 2100
2110 2120 2130
2140
2510 2520 2530 2540
2550
↓
W Nile
HIMRGGWLSCLSITWTLIKNMEKPGL--KRGGAKGRTLGEVWKERLNHMTKEEFTRYRKE
.:.::..:. :. .:. .:
:. ::::..:.:.:: ::::::.:: :: :..
Zika NIFRGSYLAGPSLIYTVTRNA---GIMKKRGGGNGETVGEKWKERLNRMTALEFYAYKRS
2500
2510 2520 2530 2540
2550
Is microcephalin a substrate for the Zika virus endopeptidase?
Could it be that the viral endopeptidase is processing host
proteins at similar sites? There are at
least 24 human proteins known to be cleaved by viral endopeptidases. Cleaving eukaryotic translation initiation
factors and polyadenylate-binding protein 1 switches off the host cell's own
protein synthesis mechanism, ensuring that only viral proteins are made, and
the endopeptidases from retroviruses, enteroviruses and foot-and-mouth disease
virus all cleave these proteins [13-17].
Nuclear pore glycoprotein p62 is also cleaved by the rhinovirus endopeptidase
picornain 2A peptidase, and this disrupts trafficking from the nucleus to the
cytoplasm [18]. Both microcephalin
(http://www.uniprot.org/uniprot/Q8NEM0) and ASPM
(http://www.uniprot.org/uniprot/Q8IZT6) have regions that conform to the
specificity of the Zika virus endopeptidase (Fig. 5) so either could be a
potential substrate and be inactivated by cleavage. If cleavage of these proteins has the same
effect as mutations in the genes, then cleavage could lead to microcephaly.
Fig. 5 Potential cleavage sites in microcephalin and ASPM
MCPH1 66 QSTWDKAQKR+GVKLVSVLWV
MCPH1
375 PPKEKCKRKR+STRRSIMPRL
MCPH1
379 KCKRKRSTRR+SIMPRLQLCR
MCPH1
467 MSDFSCVGKK+TRTVDITNFT
MCPH1
486 TAKTISSPRK+TGNGEGRATS
MCPH1
639 LIKPHEELKK+SGRGKKPTRT
ASPM 148 NAEEQKKKKR+SLWDTIKKKK
ASPM 243 ATCLPLSVRR+STTYSSLHAS
ASPM 431 VPQSPEDWRK+SEVSPRIPEC
ASPM 576 TTASVARKRK+SDGSMEDANV
ASPM 616 SEPKTSAVKK+TKNVTTPISK
ASPM 639 NREKLNLKKK+TDLSIFRTPI
ASPM 655 RTPISKTNKR+TKPIIAVAQS
ASPM
1081 FLKHTKSIKK+TISLLSCHSD
ASPM
1098 HSDDLINKKK+GKRDSGSFEQ
ASPM
1584 DRVRFLNLKK+TIIKFQAHVR
ASPM
2095 QHKEYLNLKK+TAIKIQSVYR
ASPM
2184 ASFRGVRVRR+TLRKMQTAAT
ASPM
2287 MRRRFLSLKK+TAILIQRKYR
ASPM
2712 RAKVDYETKK+TAIVVIQNYY
ASPM
3081 ERIKYIEFKK+STVILQALVR
ASPM
3252 IREENKLYKR+TALALHYLLT
Conclusions
The incidences of microcephaly in babies born to mothers
infected by the Zika virus in Brazil are not only alarmingly high, but much
higher than the background mutation rate that causes microcephaly in the UK;
there seems to be little doubt that the condition and Zika fever are
related. Whether this relationship is
because the disease is new to Brazil, mothers have no immunity and microcephaly
results from the body’s own immune response, as has been observed previously in
chickenpox, or because of the presence of a viral toxin, is not known. If the latter, then it is possible that the
proteins derived from genes in which mutations are known to cause microcephaly
are susceptible to digestion by the Zika virus polyprotein processing enzyme,
which is predicted to have a specificity similar to that of host prohormone
convertases: inactivating the proteins may have the same results as mutations
in the genes. Further research is
required to understand the mechanisms causing microcephaly, which might include
characterization of the viral endopeptidase.
If the symptoms are due to the response of the immune system, then
microcephaly might be a transitory phenomenon, and once the population builds
up immunity, such incidences could become very rare in the future.
References
1. Leviton, A., Holmes, L. B., Allred, E. N. & Vargas,
J. (2002). Methodologic issues in epidemiologic studies of congenital
microcephaly. Early Hum. Dev. 69:91-105. doi:10.1016/S0378-3782(02)00065-8. PMID:12324187.
2. Opitz, J. M. & Holt, M. C. (1990). Microcephaly:
general considerations and aids to nosology. J. Craniofac. Genet. Dev. Biol. 10:75-204.
PMID:2211965.
3. Mousson, L.,
Dauga, C., Garrigues, T., Schaffner, F., Vazeille, M. & Failloux, A. (2005). Phylogeography of Aedes (Stegomyia) aegypti (L.)
and Aedes (Stegomyia) albopictus
(Skuse) (Diptera: Culicidae) based on mitochondrial DNA variations. Genetics
Research 86:1-11. doi:10.1017/S0016672305007627. PMID:16181519.
4. Musso, D., Roche, C., Robin, E., Nhan, T., Teissier, A.
& Cao-Lormeau, V.M. (2015) Potential
sexual transmission of Zika virus. Emerg
Infect Dis 21:359-61. doi: 10.3201/eid2102.141363. PMID:25625872.
5. Jackson, A. P., Eastwood, H., Bell, S. M., Adu, J.,
Toomes, C., Carr, I. M., Roberts, E., Hampshire, Daniel J., et al. (2002). Identification of
Microcephalin, a Protein Implicated in Determining the Size of the Human Brain.
Am. J. Human Genetics 71:136-142. doi:10.1086/341283. PMC:419993. PMID:12046007.
6. Jackson, A. P., McHale, D. P., Campbell, D. A., Jafri, H.,
Rashid, Y., Mannan, J., Karbani, G., Corry, P., et al. (1998). Primary Autosomal Recessive Microcephaly (MCPH1)
Maps to Chromosome 8p22-pter. Am. J. Human Genetics 63:541-546.
doi:10.1086/301966. PMC:1377307. PMID:9683597.
7. Bond, J., Roberts, E., Mochida, G.H., Hampshire, D.J.,
Scott, S., Askham, J.M., Springell, K., Mahadevan, M., Crow, Y.J., Markham,
A.F., Walsh, C.A. & Woods, C.G. (2002) ASPM is a major determinant of
cerebral cortical size. Nat. Genet. 32:316-320.
PMID:14574646.
8. Mirlesse V. & Lebon P. (2003 ) [Chickenpox during
pregnancy]. Arch. Pediatr. 10:1113-1118. PMID:14643554.
9. World Health Organization (8 January 2016) Microcephaly -
Brazil.
10. Chappell, K. J., Stoermer, M. J., Fairlie, D. P. &
Young, P. R. (2006) Insights to substrate binding and processing by West Nile
Virus NS3 protease through combined modeling, protease mutagenesis, and kinetic
studies. J. Biol. Chem. 281:38448-38458. PMID:17052977.
11. Shiryaev, S. A., Ratnikov, B. I., Chekanov, A. V.,
Sikora, S., Rozanov, D. V., Godzik, A., Wang, J., Smith, J. W., Huang, Z.,
Lindberg, I., Samuel, M. A., Diamond, M. S. & Strongin, A. Y. (2006) Cleavage
targets and the D-arginine-based inhibitors of the West Nile virus NS3
processing proteinase. Biochem. J. 393:503-511.
PMID:16229682.
12. Remacle, A. G., Shiryaev, S. A., Oh, E. S., Cieplak, P.,
Srinivasan, A., Wei, G., Liddington, R. C., Ratnikov, B. I., Parent, A.,
Desjardins, R., Day, R., Smith, J. W., Lebl, M. & Strongin, A. Y. (2008) Substrate
cleavage analysis of furin and related proprotein convertases. A comparative
study. J. Biol. Chem. 283:20897-20906. PMID:18505722.
13. Alvarez, E., Menéndez-Arias, L., & Carrasco, L. (20030
The eukaryotic translation initiation factor 4GI is cleaved by different
retroviral proteases. J. Virol. 77:12392-12400.
14. Gradi, A., Foeger, N., Strong, R., Svitkin, Y. V.,
Sonenberg, N., Skern, T., Belsham, G. J. (2004) Cleavage of eukaryotic
translation initiation factor 4GII within foot-and-mouth disease virus-infected
cells: identification of the L-protease cleavage site in vitro. J. Virol.
78:3271-3278.
15. Gradi, A., Svitkin, Y. V., Sommergruber, W., Imataka, H.,
Morino, S., Skern, T. & Sonenberg, N. (2003) Human rhinovirus 2A proteinase
cleavage sites in eukaryotic initiation factors (eIF) 4GI and eIF4GII are
different. J. Virol. 77:5026-5029. PMID:15016848.
16. Foeger, N., Schmid, E. M. & Skern, T. (2003) Human
rhinovirus 2 2Apro recognition of eukaryotic initiation factor 4GI. Involvement
of an exosite. J. Biol. Chem. 278:33200-33207. PMID:12791690.
17. Kuyumcu-Martinez, N. M., Joachims, M. & Lloyd, R. E.
(2002) Efficient cleavage of ribosome-associated poly(A)-binding protein by
enterovirus 3C protease. J. Virol. 76:2062-2074. PMID:11836384.
18. Park, N., Skern, T. & Gustin, K. E. (2010) Specific
cleavage of the nuclear pore complex protein Nup62 by a viral protease. J. Biol Chem. 285:28796-805. doi:10.1074/jbc.M110.143404. PMID:20622012.
You mentioned that zika isn't present among africans because women build up an immunity to chickenpox when they are girls,the problem with that is chickenpox isn't prevelant in africa so why would they need to have immunity against it? Chickenpox is a form of hpv which again africans dont get unless they visit other parts of the world where the disease is prevelant.
ReplyDeleteAlso blacks lack the aspm gene,making it an impissibility for it to be manipulated by any virus.
in the fastest conceivable way, Kolkata escorts Taken in a ton from your review.
ReplyDeleteEscorts in Kolkata
Kolkata Escorts Services
Escorts Services in Kolkata
Thanks for writing such a good article, I stumbled onto your blog and read a few post. I like your style of writing... Buy email database
ReplyDeleteI really like your Blog. Thanks to Admin for Sharing such useful information. Addition to this here I am sharing One more similar Story Zika Virus Symptoms, Treatment and Precautions (STD).
ReplyDeleteForeigner Escorts Hyderabad
ReplyDeleteVIP Foreigner Escorts Hyderabad
Call Girls Services in Hyderabad
Russian Call Girls Hyderabad
Russian Call Girls
Russian Escorts in Hyderabad
high class Celebrity Escort Hyderabad
Call Girls Services in Hyderabad
Hot Russian escorts in Hyderabad
Russian Call Girls in Hyderabad
Here is a great herbal doctor who cured me of Hepatitis B. his name is Dr. Imoloa. I suffered Hepatitis B for 11 years, I was very weak with pains all over my body my stomach was swollen and I could hardly eat. And one day my brother came with a herbal medicine from doctor Imoloa and asked me to drink and I drank hence there was no hope, and behold after 2 week of taking the medicine, I started feeling relief, my swollen stomach started shrinking down and the pains was gone. I became normal after the completion of the medication, I went to the hospital and I was tested negative which means I’m cured. He can also cure the following diseases with his herbal medicine...lupus, hay fever, measles, dry cough, diabetics hepatitis A.B.C, mouth ulcer, mouth cancer, bile salt disease, fol ate deficinecy, diarrhoea, liver/kidney inflammatory, eye cancer, skin cancer disease, malaria, chronic kidney disease, high blood pressure, food poisoning, parkinson disease, bowel cancer, bone cancer, brain tumours, asthma, arthritis, epilepsy, cystic fibrosis, lyme disease, muscle aches, cholera, fatigue, muscle aches, shortness of breath, alzhemer's disease, acute myeloid leukaemia, acute pancreatitis, chronic inflammatory joint disease, inflammatory bowel disease, Addison's disease back acne, breast cancer, allergic bronchitis, Celia disease, bulimia, congenital heart disease, cirrhosis, fetal alcohol spectrum, constipation, fungal nail infection, fabromyalgia, (love spell) and many more. he is a great herbalist man. Contact him on email; drimolaherbalmademedicine@gmail.com. You can also reach him on whatssap- +2347081986098.
ReplyDeleteVIP Celebrity Escorts in Bangalore
ReplyDelete